IL1B (Equine) Recombinant Protein
  • IL1B (Equine) Recombinant Protein

IL1B (Equine) Recombinant Protein

Ref: AB-P8226
IL1B (Equine) Recombinant Protein

Información del producto

Equine IL1B (Q28386, 116 a.a. - 268 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IL1B
Gene Alias IL-1B
Gene Description interleukin 1, beta
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AAMHSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGEEETDKIPVALGLKEKNLYLSCGMKDGKPTLQLETVDPNTYPKRKMEKRFVFNKMEIKGNVEFESAMYPNWYISTSQAEKSPVFLGNTRGGRDITDFIMEITSA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 100034237

Enviar uma mensagem


IL1B (Equine) Recombinant Protein

IL1B (Equine) Recombinant Protein