Fgf9 (Mouse) Recombinant Protein
  • Fgf9 (Mouse) Recombinant Protein

Fgf9 (Mouse) Recombinant Protein

Ref: AB-P8223
Fgf9 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf9 (P54130, 3 a.a. - 207 a.a.) partial recombinant protein with expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Fgf9
Gene Alias -
Gene Description fibroblast growth factor 9
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQ
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 14180

Enviar uma mensagem


Fgf9 (Mouse) Recombinant Protein

Fgf9 (Mouse) Recombinant Protein