Il1b (Mouse) Recombinant Protein
  • Il1b (Mouse) Recombinant Protein

Il1b (Mouse) Recombinant Protein

Ref: AB-P8221
Il1b (Mouse) Recombinant Protein

Información del producto

Mouse Il1b (P10749, 117 a.a. - 269 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Il1b
Gene Alias IL-1beta|Il-1b
Gene Description interleukin 1 beta
Storage Conditions Store at 4C for 2-4 weeks. For long term storage, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris pH 8.0 (10% glycerol)
Gene ID 16176

Enviar uma mensagem


Il1b (Mouse) Recombinant Protein

Il1b (Mouse) Recombinant Protein