IL1A (Canine) Recombinant Protein
  • IL1A (Canine) Recombinant Protein

IL1A (Canine) Recombinant Protein

Ref: AB-P8216
IL1A (Canine) Recombinant Protein

Información del producto

Canine IL1A (O46612, 109 a.a. - 265 a.a.) partial recombinant protein with His tag at C-teminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name cnc-3
Gene Alias -
Gene Description CaeNaCin (Caenorhabditis bacteriocin)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPSVAYNFHNNEKYNYIRIIKSQFILNDNLNQSIVRQTGGNYLMTAALQNLDDAVKFDMGAYTSEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKHYFKSVAQPKLFIATQERKLVHMARGQPSITDFRLLETQPHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 178636

Enviar uma mensagem


IL1A (Canine) Recombinant Protein

IL1A (Canine) Recombinant Protein