Il1a (Mouse) Recombinant Protein
  • Il1a (Mouse) Recombinant Protein

Il1a (Mouse) Recombinant Protein

Ref: AB-P8209
Il1a (Mouse) Recombinant Protein

Información del producto

Mouse Il1a (P01582, 115 a.a. - 270 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Il1a
Gene Alias Il-1a
Gene Description interleukin 1 alpha
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 16175

Enviar uma mensagem


Il1a (Mouse) Recombinant Protein

Il1a (Mouse) Recombinant Protein