IHH (Human) Recombinant Protein
  • IHH (Human) Recombinant Protein

IHH (Human) Recombinant Protein

Ref: AB-P8202
IHH (Human) Recombinant Protein

Información del producto

Human IHH (Q14623, 27 a.a. - 202 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name IHH
Gene Alias BDA1|HHG2
Gene Description Indian hedgehog homolog (Drosophila)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 3549

Enviar uma mensagem


IHH (Human) Recombinant Protein

IHH (Human) Recombinant Protein