View larger
Human IGFBP7 (Q16270, 27 a.a. - 282 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8200
New product
IGFBP7 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | IGFBP7 |
| Gene Alias | FSTL2|IGFBP-7|IGFBP-7v|IGFBPRP1|MAC25|PSF |
| Gene Description | insulin-like growth factor binding protein 7 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAE |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In sterile 20mM AcOH (acetic Acid) > |
| Gene ID | 3490 |
More info
Human IGFBP7 (Q16270, 27 a.a. - 282 a.a.) partial recombinant protein expressed in Escherichia coli.