Igfbp6 (Mouse) Recombinant Protein
  • Igfbp6 (Mouse) Recombinant Protein

Igfbp6 (Mouse) Recombinant Protein

Ref: AB-P8199
Igfbp6 (Mouse) Recombinant Protein

Información del producto

Mouse Igfbp6 (P47880, 26 a.a. - 238 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name Igfbp6
Gene Alias IGFBP-6
Gene Description insulin-like growth factor binding protein 6
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQPCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSGLEHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (40% glycerol)
Gene ID 16012

Enviar uma mensagem


Igfbp6 (Mouse) Recombinant Protein

Igfbp6 (Mouse) Recombinant Protein