IGFBP6 (Human) Recombinant Protein
  • IGFBP6 (Human) Recombinant Protein

IGFBP6 (Human) Recombinant Protein

Ref: AB-P8198
IGFBP6 (Human) Recombinant Protein

Información del producto

Human IGFBP6 (P24592, 28 a.a. - 240 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IGFBP6
Gene Alias IBP6
Gene Description insulin-like growth factor binding protein 6
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSRCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.15M NaCl, 1mM DTT, 20% glycerol)
Gene ID 3489

Enviar uma mensagem


IGFBP6 (Human) Recombinant Protein

IGFBP6 (Human) Recombinant Protein