IGFBP6 (Human) Recombinant Protein View larger

Human IGFBP6 (P24592, 28 a.a. - 240 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia col

AB-P8198

New product

IGFBP6 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name IGFBP6
Gene Alias IBP6
Gene Description insulin-like growth factor binding protein 6
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSRCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.15M NaCl, 1mM DTT, 20% glycerol)
Gene ID 3489

More info

Human IGFBP6 (P24592, 28 a.a. - 240 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human IGFBP6 (P24592, 28 a.a. - 240 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia col

Human IGFBP6 (P24592, 28 a.a. - 240 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia col