INFG (Human) Recombinant Protein
  • INFG (Human) Recombinant Protein

INFG (Human) Recombinant Protein

Ref: AB-P8139
INFG (Human) Recombinant Protein

Información del producto

Human INFG recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name IFNG
Gene Alias IFG|IFI
Gene Description interferon, gamma
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at-20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 4.6. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL in phosphate buffer pH >
Gene ID 3458

Enviar uma mensagem


INFG (Human) Recombinant Protein

INFG (Human) Recombinant Protein