Lif (Mouse) Recombinant Protein
  • Lif (Mouse) Recombinant Protein

Lif (Mouse) Recombinant Protein

Ref: AB-P8133
Lif (Mouse) Recombinant Protein

Información del producto

Mouse LIF (P09056) recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Lif
Gene Alias -
Gene Description leukemia inhibitory factor
Storage Conditions Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20C. Upon reconstitution should be stored at 4Cbetween 2-7 days and for future use below -20C. For long term storage it is recommended to add a carrier protein
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20
Gene ID 16878

Enviar uma mensagem


Lif (Mouse) Recombinant Protein

Lif (Mouse) Recombinant Protein