IL1B (Human) Recombinant Protein View larger

Human IL1B (P01584, 117 a.a. - 269 a.a.) partial length recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8123

New product

IL1B (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name IL1B
Gene Alias IL-1|IL1-BETA|IL1F2
Gene Description interleukin 1, beta
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/ml
Gene ID 3553

More info

Human IL1B (P01584, 117 a.a. - 269 a.a.) partial length recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human IL1B (P01584, 117 a.a. - 269 a.a.) partial length recombinant protein expressed in <i>Escherichia coli</i>.

Human IL1B (P01584, 117 a.a. - 269 a.a.) partial length recombinant protein expressed in <i>Escherichia coli</i>.