CTSF (Human) Recombinant Protein
  • CTSF (Human) Recombinant Protein

CTSF (Human) Recombinant Protein

Ref: AB-P8108
CTSF (Human) Recombinant Protein

Información del producto

Human CTSF (Q9UBX1, 20 a.a. - 484 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name CTSF
Gene Alias CATSF
Gene Description cathepsin F
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APAQPRAASFQAWGPPSPELLAPTRFALEMFNRGRAAGTRAVLGLVRGRVRRAGQGSLYSLEATLEEPPCNDPMVCRLPVSKKTLLCSFQVLDELGRHVLLRKDCGPVDTKVPGAGEPKSAFTQGSAMISSLSQNHPDNRNETFSSVISLLNEDPLSQDLPVKMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGTAQYGVTKFSDLTEEEFRTIYLNTLLRKEPGNKMKQAKSVGDLAPPE
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (40% glycerol)
Gene ID 8722

Enviar uma mensagem


CTSF (Human) Recombinant Protein

CTSF (Human) Recombinant Protein