Tnfsf4 (Mouse) Recombinant Protein
  • Tnfsf4 (Mouse) Recombinant Protein

Tnfsf4 (Mouse) Recombinant Protein

Ref: AB-P8106
Tnfsf4 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfsf4 (P43488, 51 a.a. - 198 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name Tnfsf4
Gene Alias Ath-1|Ath1|CD134L|OX-40L|Ox40l|TXGP1|Txgp1l|gp34
Gene Description tumor necrosis factor (ligand) superfamily, member 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 22164

Enviar uma mensagem


Tnfsf4 (Mouse) Recombinant Protein

Tnfsf4 (Mouse) Recombinant Protein