View larger
Human IL25 (Q9H293, 33 a.a. - 177 a.a.) partial length recombinant protein His tag expressed in HEK293 expression system.
AB-P8104
New product
IL25 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | IL25 |
| Gene Alias | IL-17E|IL-25|IL17E |
| Gene Description | interleukin 25 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (20% glycerol) |
| Gene ID | 64806 |
More info
Human IL25 (Q9H293, 33 a.a. - 177 a.a.) partial length recombinant protein His tag expressed in HEK293 expression system.