Ace2 (Mouse) Recombinant Protein
  • Ace2 (Mouse) Recombinant Protein

Ace2 (Mouse) Recombinant Protein

Ref: AB-P8100
Ace2 (Mouse) Recombinant Protein

Información del producto

Mouse Ace2 (Q8R0I0, 18 a.a. - 740 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name Ace2
Gene Alias 2010305L05Rik
Gene Description angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QSLTEENAKTFLNNFNQEAEDLSYQSSLASWNYNTNITEENAQKMSEAAAKWSAFYEEQSKTAQSFSLQEIQTPIIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQECLLLEPGLDEIMATSTDYNSRLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYNDYGDYWRGDYEAEGADGYNYNRNQLIEDVERTFAEIKPLYEHLHAYVRRKLMDTYPSYISPTGCLPAHLLGDMWG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 70008

Enviar uma mensagem


Ace2 (Mouse) Recombinant Protein

Ace2 (Mouse) Recombinant Protein