CD200 (Human) Recombinant Protein View larger

Human CD200 (P41217, 31 a.a. - 232 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.

AB-P8099

New product

CD200 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.


Data sheet

Size 100 ug
Gene Name CD200
Gene Alias MOX1|MOX2|MRC|OX-2
Gene Description CD200 molecule
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 4345

More info

Human CD200 (P41217, 31 a.a. - 232 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human CD200 (P41217, 31 a.a. - 232 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.

Human CD200 (P41217, 31 a.a. - 232 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.