View larger
Mouse Entpd6 (Q3U0P5, 33 a.a. - 455 a.a.) partial length recombinant protein His tag expressed in HEK293 expression system.
AB-P8089
New product
Entpd6 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | Entpd6 |
| Gene Alias | 2700026H11Rik|Cd39l2|NTPDase-6 |
| Gene Description | ectonucleoside triphosphate diphosphohydrolase 6 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | KWHRASAAQAFFTIAGAASGARWTQQAFSSPGSAARGHEVFYGIMFDAGSTGTRIHVFQFARPPGETPTLTHETFKALKPGLSAYADDVEKSAQGIQELLNVAKQHIPYDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITVNFLTGSLKTPGSSSVGMLDLGGGSTQITFLPRVEGTLQASPPGHLTALQMFNRTYKLYSYSYLGLGLMSARLAILGGVEGKPA |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (20% glycerol) |
| Gene ID | 12497 |
More info
Mouse Entpd6 (Q3U0P5, 33 a.a. - 455 a.a.) partial length recombinant protein His tag expressed in HEK293 expression system.