Entpd6 (Mouse) Recombinant Protein
  • Entpd6 (Mouse) Recombinant Protein

Entpd6 (Mouse) Recombinant Protein

Ref: AB-P8089
Entpd6 (Mouse) Recombinant Protein

Información del producto

Mouse Entpd6 (Q3U0P5, 33 a.a. - 455 a.a.) partial length recombinant protein His tag expressed in HEK293 expression system.
Información adicional
Size 100 ug
Gene Name Entpd6
Gene Alias 2700026H11Rik|Cd39l2|NTPDase-6
Gene Description ectonucleoside triphosphate diphosphohydrolase 6
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KWHRASAAQAFFTIAGAASGARWTQQAFSSPGSAARGHEVFYGIMFDAGSTGTRIHVFQFARPPGETPTLTHETFKALKPGLSAYADDVEKSAQGIQELLNVAKQHIPYDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITVNFLTGSLKTPGSSSVGMLDLGGGSTQITFLPRVEGTLQASPPGHLTALQMFNRTYKLYSYSYLGLGLMSARLAILGGVEGKPA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (20% glycerol)
Gene ID 12497

Enviar uma mensagem


Entpd6 (Mouse) Recombinant Protein

Entpd6 (Mouse) Recombinant Protein