CSH1 (Human) Recombinant Protein
  • CSH1 (Human) Recombinant Protein

CSH1 (Human) Recombinant Protein

Ref: AB-P8076
CSH1 (Human) Recombinant Protein

Información del producto

Human CSH1 (P0DML2, 27 a.a. - 217 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name CSH1
Gene Alias CSA|CSMT|FLJ75407|PL
Gene Description chorionic somatomammotropin hormone 1 (placental lactogen)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (30% glycerol)
Gene ID 1442

Enviar uma mensagem


CSH1 (Human) Recombinant Protein

CSH1 (Human) Recombinant Protein