TEK (Human) Recombinant Protein
  • TEK (Human) Recombinant Protein

TEK (Human) Recombinant Protein

Ref: AB-P8075
TEK (Human) Recombinant Protein

Información del producto

Human TEK (Q02763, 23 a.a. - 748 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name TEK
Gene Alias CD202B|TIE-2|TIE2|VMCM|VMCM1
Gene Description TEK tyrosine kinase, endothelial
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSY
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 7010

Enviar uma mensagem


TEK (Human) Recombinant Protein

TEK (Human) Recombinant Protein