BACE1 (Human) Recombinant Protein
  • BACE1 (Human) Recombinant Protein

BACE1 (Human) Recombinant Protein

Ref: AB-P8066
BACE1 (Human) Recombinant Protein

Información del producto

Human BACE1 (P56817, 22 a.a. - 457 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name BACE1
Gene Alias ASP2|BACE|FLJ90568|HSPC104|KIAA1149
Gene Description beta-site APP-cleaving enzyme 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKM
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 23621

Enviar uma mensagem


BACE1 (Human) Recombinant Protein

BACE1 (Human) Recombinant Protein