BGN (Human) Recombinant Protein View larger

Human BGN (P21810, 38 a.a. - 368 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syste

AB-P8045

New product

BGN (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 50 ug
Gene Name BGN
Gene Alias DSPG1|PG-S1|PGI|SLRR1A
Gene Description biglycan
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARV
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 633

More info

Human BGN (P21810, 38 a.a. - 368 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human BGN (P21810, 38 a.a. - 368 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syste

Human BGN (P21810, 38 a.a. - 368 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syste