GZMB (Human) Recombinant Protein View larger

Human GZMB (P10144, 19 a.a. - 247 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst

AB-P8044

New product

GZMB (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 20 ug
Gene Name GZMB
Gene Alias CCPI|CGL-1|CGL1|CSP-B|CSPB|CTLA1|CTSGL1|HLP|SECT
Gene Description granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (20% glycerol, 1 mM DTT)
Gene ID 3002

More info

Human GZMB (P10144, 19 a.a. - 247 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human GZMB (P10144, 19 a.a. - 247 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst

Human GZMB (P10144, 19 a.a. - 247 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst