IL1RL1 (Human) Recombinant Protein View larger

Human IL1RL1 (Q01638, 19 a.a. - 328 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sy

AB-P8043

New product

IL1RL1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 50 ug
Gene Name IL1RL1
Gene Alias DER4|FIT-1|MGC32623|ST2|ST2L|ST2V|T1
Gene Description interleukin 1 receptor-like 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQN
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 9173

More info

Human IL1RL1 (Q01638, 19 a.a. - 328 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human IL1RL1 (Q01638, 19 a.a. - 328 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sy

Human IL1RL1 (Q01638, 19 a.a. - 328 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sy