CSF2RA (Human) Recombinant Protein View larger

Human CSF2RA (P15509, 20 a.a. - 320 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressi

AB-P8030

New product

CSF2RA (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 20 ug
Gene Name CSF2RA
Gene Alias CD116|CDw116|CSF2R|CSF2RAX|CSF2RAY|CSF2RX|CSF2RY|GM-CSF-R-alpha|GMCSFR|GMR|MGC3848|MGC4838
Gene Description colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq LIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVS
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 1438

More info

Human CSF2RA (P15509, 20 a.a. - 320 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human CSF2RA (P15509, 20 a.a. - 320 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressi

Human CSF2RA (P15509, 20 a.a. - 320 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressi