KLRK1 (Human) Recombinant Protein
  • KLRK1 (Human) Recombinant Protein

KLRK1 (Human) Recombinant Protein

Ref: AB-P8025
KLRK1 (Human) Recombinant Protein

Información del producto

Human KLRK1 (P26718, 73 a.a. - 216 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name KLRK1
Gene Alias CD314|D12S2489E|FLJ17759|FLJ75772|KLR|NKG2-D|NKG2D
Gene Description killer cell lectin-like receptor subfamily K, member 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 22914

Enviar uma mensagem


KLRK1 (Human) Recombinant Protein

KLRK1 (Human) Recombinant Protein