ECHS1 (Human) Recombinant Protein
  • ECHS1 (Human) Recombinant Protein

ECHS1 (Human) Recombinant Protein

Ref: AB-P8016
ECHS1 (Human) Recombinant Protein

Información del producto

Human ECHS1 (P30084, 28 a.a. - 290 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name ECHS1
Gene Alias SCEH
Gene Description enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEK
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (20% glycerol, 100 mM NaCl, 1 mM DTT)
Gene ID 1892

Enviar uma mensagem


ECHS1 (Human) Recombinant Protein

ECHS1 (Human) Recombinant Protein