PGP (Human) Recombinant Protein
  • PGP (Human) Recombinant Protein

PGP (Human) Recombinant Protein

Ref: AB-P8014
PGP (Human) Recombinant Protein

Información del producto

Human PGP (A6NDG6, 1 a.a. - 321 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PGP
Gene Alias MGC4692
Gene Description phosphoglycolate phosphatase
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNSSKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERT
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.15 M NaCl, 1 mM DTT)
Gene ID 283871

Enviar uma mensagem


PGP (Human) Recombinant Protein

PGP (Human) Recombinant Protein