DUSP23 (Human) Recombinant Protein
  • DUSP23 (Human) Recombinant Protein

DUSP23 (Human) Recombinant Protein

Ref: AB-P8013
DUSP23 (Human) Recombinant Protein

Información del producto

Human DUSP23 (Q9BVJ7, 1 a.a. - 150 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name DUSP23
Gene Alias DUSP25|FLJ20442|LDP-3|MOSP|RP11-190A12.1|VHZ
Gene Description dual specificity phosphatase 23
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 100 mM NaCl, 2 mM DTT)
Gene ID 54935

Enviar uma mensagem


DUSP23 (Human) Recombinant Protein

DUSP23 (Human) Recombinant Protein