DUSP18 (Human) Recombinant Protein
  • DUSP18 (Human) Recombinant Protein

DUSP18 (Human) Recombinant Protein

Ref: AB-P8012
DUSP18 (Human) Recombinant Protein

Información del producto

Human DUSP18 (Q8NEJ0, 1 a.a. - 188 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name DUSP18
Gene Alias DSP18|DUSP20|LMWDSP20|MGC32658|bK963H5.1
Gene Description dual specificity phosphatase 18
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (40% glycerol, 1 mM EDTA, 1 mM DTT, 0.1 mM PMSF)
Gene ID 150290

Enviar uma mensagem


DUSP18 (Human) Recombinant Protein

DUSP18 (Human) Recombinant Protein