ENTPD3 (Human) Recombinant Protein
  • ENTPD3 (Human) Recombinant Protein

ENTPD3 (Human) Recombinant Protein

Ref: AB-P8002
ENTPD3 (Human) Recombinant Protein

Información del producto

Human ENTPD3 (O75355, 44 a.a. - 485 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 20 ug
Gene Name ENTPD3
Gene Alias CD39L3|FLJ93839|HB6|NTPDase-3
Gene Description ectonucleoside triphosphate diphosphohydrolase 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISF
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 956

Enviar uma mensagem


ENTPD3 (Human) Recombinant Protein

ENTPD3 (Human) Recombinant Protein