EPOR (Human) Recombinant Protein
  • EPOR (Human) Recombinant Protein

EPOR (Human) Recombinant Protein

Ref: AB-P7998
EPOR (Human) Recombinant Protein

Información del producto

Human EPOR (P19235, 25 a.a. - 250 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 50 ug
Gene Name EPOR
Gene Alias MGC138358
Gene Description erythropoietin receptor
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 2057

Enviar uma mensagem


EPOR (Human) Recombinant Protein

EPOR (Human) Recombinant Protein