Ctsb (Mouse) Recombinant Protein View larger

Mouse Ctsb (P10605, 18 a.a. - 339 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst

AB-P7995

New product

Ctsb (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 50 ug
Gene Name Ctsb
Gene Alias -
Gene Description cathepsin B
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 13030

More info

Mouse Ctsb (P10605, 18 a.a. - 339 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Mouse Ctsb (P10605, 18 a.a. - 339 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst

Mouse Ctsb (P10605, 18 a.a. - 339 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst