VCAM1 (Human) Recombinant Protein
  • VCAM1 (Human) Recombinant Protein

VCAM1 (Human) Recombinant Protein

Ref: AB-P7993
VCAM1 (Human) Recombinant Protein

Información del producto

Human VCAM1 (P19320, 25 a.a. - 698 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 250 ug
Gene Name VCAM1
Gene Alias CD106|DKFZp779G2333|INCAM-100|MGC99561
Gene Description vascular cell adhesion molecule 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLI
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 7412

Enviar uma mensagem


VCAM1 (Human) Recombinant Protein

VCAM1 (Human) Recombinant Protein