Uchl3 (Mouse) Recombinant Protein
  • Uchl3 (Mouse) Recombinant Protein

Uchl3 (Mouse) Recombinant Protein

Ref: AB-P7981
Uchl3 (Mouse) Recombinant Protein

Información del producto

Mouse Uchl3 (Q9JKB1, 1 a.a. - 230 a.a.) full length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 50 ug
Gene Name Uchl3
Gene Alias -
Gene Description ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 50933

Enviar uma mensagem


Uchl3 (Mouse) Recombinant Protein

Uchl3 (Mouse) Recombinant Protein