IL3 (Human) Recombinant Protein
  • IL3 (Human) Recombinant Protein

IL3 (Human) Recombinant Protein

Ref: AB-P7976
IL3 (Human) Recombinant Protein

Información del producto

Human IL3 (P08700, 20 a.a. - 152 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 20 ug
Gene Name IL3
Gene Alias IL-3|MCGF|MGC79398|MGC79399|MULTI-CSF
Gene Description interleukin 3 (colony-stimulating factor, multiple)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 3562

Enviar uma mensagem


IL3 (Human) Recombinant Protein

IL3 (Human) Recombinant Protein