TNFSF8 (Human) Recombinant Protein
  • TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein

Ref: AB-P7975
TNFSF8 (Human) Recombinant Protein

Información del producto

Human TNFSF8 (P32971, 63 a.a. - 234 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name TNFSF8
Gene Alias CD153|CD30L|CD30LG|MGC138144
Gene Description tumor necrosis factor (ligand) superfamily, member 8
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 944

Enviar uma mensagem


TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein