View larger
Human TNFSF8 (P32971, 63 a.a. - 234 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sy
AB-P7975
New product
TNFSF8 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | TNFSF8 |
| Gene Alias | CD153|CD30L|CD30LG|MGC138144 |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 8 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 944 |
More info
Human TNFSF8 (P32971, 63 a.a. - 234 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.