Cst3 (Rat) Recombinant Protein
  • Cst3 (Rat) Recombinant Protein

Cst3 (Rat) Recombinant Protein

Ref: AB-P7972
Cst3 (Rat) Recombinant Protein

Información del producto

Rat Cst3 (P14841, 21 a.a. - 140 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 250 ug
Gene Name Cst3
Gene Alias CYSC|MGC105556
Gene Description cystatin C
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 25307

Enviar uma mensagem


Cst3 (Rat) Recombinant Protein

Cst3 (Rat) Recombinant Protein