View larger
Rat Cst3 (P14841, 21 a.a. - 140 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system
AB-P7972
New product
Cst3 (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 11 pontos de fidelização. Seu carrinho totalizará 11 pontos de fidelização que podem ser convertidos num vale de desconto de 44.00EUR.
Data sheet
| Size | 250 ug |
| Gene Name | Cst3 |
| Gene Alias | CYSC|MGC105556 |
| Gene Description | cystatin C |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 25307 |
More info
Rat Cst3 (P14841, 21 a.a. - 140 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.