SORD (Human) Recombinant Protein
  • SORD (Human) Recombinant Protein

SORD (Human) Recombinant Protein

Ref: AB-P7970
SORD (Human) Recombinant Protein

Información del producto

Human SORD (Q00796, 1 a.a. - 357 a.a.) full length recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name SORD
Gene Alias SORD1
Gene Description sorbitol dehydrogenase
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.5 (10% glycerol, 1 mM DTT)
Gene ID 6652

Enviar uma mensagem


SORD (Human) Recombinant Protein

SORD (Human) Recombinant Protein