CST6 (Human) Recombinant Protein
  • CST6 (Human) Recombinant Protein

CST6 (Human) Recombinant Protein

Ref: AB-P7966
CST6 (Human) Recombinant Protein

Información del producto

Human CST6 (Q15828, 29 a.a. - 149 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name CST6
Gene Alias -
Gene Description cystatin E/M
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT)
Gene ID 1474

Enviar uma mensagem


CST6 (Human) Recombinant Protein

CST6 (Human) Recombinant Protein