Lgals3 (Mouse) Recombinant Protein
  • Lgals3 (Mouse) Recombinant Protein

Lgals3 (Mouse) Recombinant Protein

Ref: AB-P7961
Lgals3 (Mouse) Recombinant Protein

Información del producto

Mouse Lgals3 (Q9CQW5, 1 a.a. - 264 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Lgals3
Gene Alias GBP|L-34|Mac-2|gal3
Gene Description lectin, galactose binding, soluble 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDIT
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (50% glycerol, 0.15 M NaCl, 1 mM DTT, 2 mM EDTA)
Gene ID 16854

Enviar uma mensagem


Lgals3 (Mouse) Recombinant Protein

Lgals3 (Mouse) Recombinant Protein