Lgals2 (Mouse) Recombinant Protein
  • Lgals2 (Mouse) Recombinant Protein

Lgals2 (Mouse) Recombinant Protein

Ref: AB-P7960
Lgals2 (Mouse) Recombinant Protein

Información del producto

Mouse Lgals2 (Q9CQW5, 1 a.a. - 130 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Lgals2
Gene Alias 2200008F12Rik|AI324147
Gene Description lectin, galactose-binding, soluble 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT)
Gene ID 107753

Enviar uma mensagem


Lgals2 (Mouse) Recombinant Protein

Lgals2 (Mouse) Recombinant Protein