GPT (Human) Recombinant Protein
  • GPT (Human) Recombinant Protein

GPT (Human) Recombinant Protein

Ref: AB-P7949
GPT (Human) Recombinant Protein

Información del producto

Human GPT (P24298, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name GPT
Gene Alias AAT1|ALT1|GPT1
Gene Description glutamic-pyruvate transaminase (alanine aminotransferase)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECI
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (20% glycerol, 2 mM DTT)
Gene ID 2875

Enviar uma mensagem


GPT (Human) Recombinant Protein

GPT (Human) Recombinant Protein