View larger
Human GPT (P24298, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P7949
New product
GPT (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | GPT |
| Gene Alias | AAT1|ALT1|GPT1 |
| Gene Description | glutamic-pyruvate transaminase (alanine aminotransferase) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECI |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (20% glycerol, 2 mM DTT) |
| Gene ID | 2875 |
More info
Human GPT (P24298, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.