Gpt (Rat) Recombinant Protein
  • Gpt (Rat) Recombinant Protein

Gpt (Rat) Recombinant Protein

Ref: AB-P7948
Gpt (Rat) Recombinant Protein

Información del producto

Rat Gpt (P25409, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Gpt
Gene Alias Gpt1
Gene Description glutamic-pyruvate transaminase (alanine aminotransferase)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MASRVNDQSQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVSGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECI
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 81670

Enviar uma mensagem


Gpt (Rat) Recombinant Protein

Gpt (Rat) Recombinant Protein