View larger
Rat Gpt (P25409, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P7948
New product
Gpt (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | Gpt |
| Gene Alias | Gpt1 |
| Gene Description | glutamic-pyruvate transaminase (alanine aminotransferase) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MASRVNDQSQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVSGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECI |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 81670 |
More info
Rat Gpt (P25409, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.