PDIA6 (Human) Recombinant Protein
  • PDIA6 (Human) Recombinant Protein

PDIA6 (Human) Recombinant Protein

Ref: AB-P7940
PDIA6 (Human) Recombinant Protein

Información del producto

Human PDIA6 (Q15084, 20 a.a. - 440 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PDIA6
Gene Alias ERP5|P5|TXNDC7
Gene Description protein disulfide isomerase family A, member 6
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAP
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 50 mM NaCl, 2 mM DTT)
Gene ID 10130

Enviar uma mensagem


PDIA6 (Human) Recombinant Protein

PDIA6 (Human) Recombinant Protein