CST5 (Human) Recombinant Protein
  • CST5 (Human) Recombinant Protein

CST5 (Human) Recombinant Protein

Ref: AB-P7935
CST5 (Human) Recombinant Protein

Información del producto

Human CST5 (P28325, 26 a.a. - 142 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name CST5
Gene Alias MGC71922
Gene Description cystatin D
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 1473

Enviar uma mensagem


CST5 (Human) Recombinant Protein

CST5 (Human) Recombinant Protein