Lgals4 (Mouse) Recombinant Protein View larger

Mouse Lgals4 (Q8K419, 1 a.a. - 326 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P7927

New product

Lgals4 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name Lgals4
Gene Alias galectin-4
Gene Description lectin, galactose binding, soluble 4
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFM
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT)
Gene ID 16855

More info

Mouse Lgals4 (Q8K419, 1 a.a. - 326 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Mouse Lgals4 (Q8K419, 1 a.a. - 326 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Mouse Lgals4 (Q8K419, 1 a.a. - 326 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.