View larger
Trimeric Spike (S) (QHD43416.1) partial recombinant protein expressed in HEK293 cells.
AB-P7921
New product
Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein
Ao comprar este produto pode ganhar até 13 pontos de fidelização. Seu carrinho totalizará 13 pontos de fidelização que podem ser convertidos num vale de desconto de 52.00EUR.
Data sheet
| Size | 100 ug |
| Storage Conditions | Store at 4ºC for up to one month. Aliquots should be stored at-20ºC to -80ºC.<br>Avoid repeated freeze/thaw cycles. |
| Application Key | ELISA,SDS-PAGE |
| Immunogen Prot. Seq | QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVG |
| Form | Liquid |
| Recomended Dilution | Enzyme-linked Immunoabsorbent Assay<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In 0.01 M PBS, 150 mM NaCl, pH 7.2 - 7.4. |
| Gene ID | 1791269090 |
More info
Trimeric Spike (S) (QHD43416.1) partial recombinant protein expressed in HEK293 cells.