Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein
  • Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein

Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein

Ref: AB-P7921
Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein

Información del producto

Trimeric Spike (S) (QHD43416.1) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 100 ug
Storage Conditions Store at 4C for up to one month. Aliquots should be stored at-20C to -80C.
Avoid repeated freeze/thaw cycles.
Application Key ELISA,SDS-PAGE
Immunogen Prot. Seq QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVG
Form Liquid
Recomended Dilution Enzyme-linked Immunoabsorbent Assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In 0.01 M PBS, 150 mM NaCl, pH 7.2 - 7.4.
Gene ID 1791269090

Enviar uma mensagem


Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein

Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein