SPON1 (Human) Recombinant Protein
  • SPON1 (Human) Recombinant Protein

SPON1 (Human) Recombinant Protein

Ref: AB-P7910
SPON1 (Human) Recombinant Protein

Información del producto

Human SPON1 (Q9HCB6, 29 a.a. - 807 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name SPON1
Gene Alias KIAA0762|MGC10724|f-spondin
Gene Description spondin 1, extracellular matrix protein
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq FSDETLDKVPKSEGYCSRILRAQGTRREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREGDKEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVI
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (30% glycerol)
Gene ID 10418

Enviar uma mensagem


SPON1 (Human) Recombinant Protein

SPON1 (Human) Recombinant Protein