TNF (Bovine) Recombinant Protein
  • TNF (Bovine) Recombinant Protein

TNF (Bovine) Recombinant Protein

Ref: AB-P7904
TNF (Bovine) Recombinant Protein

Información del producto

Bovine TNF (Q06599, 78 a.a. - 234 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name TNF
Gene Alias TNFa
Gene Description tumor necrosis factor (TNF superfamily, member 2)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Bovine
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 280943

Enviar uma mensagem


TNF (Bovine) Recombinant Protein

TNF (Bovine) Recombinant Protein